Note: Dry Ice fees will be extra-charged
Uniprot: Q9BQ83
Gene Name: SLX1A,SLX1B
Expression System: Escherichia coli
Molecular Weight: 15 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 68%
Start Site: Leu151
End Site: Glu260
Coverage: 0.46
Isoelectric Point: 4
Core Sequence: LAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 68%
Alternative gene names: GIYD1; SLX1,GIYD2; SLX1
Alternative protein names: Structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1
Protein name: SLX1 homolog A, structure-specific endonuclease subunit,SLX1 homolog B, structure-specific endonuclease subunit
Full length: 275 amino acids
Entry name: SLX1_HUMAN
Product panel: Enzyme
English
Deutsch
