Recombinant Human SMARCD2 Protein

Recombinant Human SMARCD2 Protein
SKU
ASBPP-10416-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92925

Gene Name: SMARCD2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: His391

End Site: Glu490

Coverage: 0.20

Isoelectric Point: 5

Core Sequence: HVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: BAF60B

Alternative protein names: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2; 60 kDa BRG-1/Brm-associated factor subunit B; BRG1-associated factor 60B; BAF60B

Protein name: SWI/SNF related BAF chromatin remodeling complex subunit D2

Full length: 531 amino acids

Entry name: SMRD2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10416-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10416-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6603
Product information (PDF)
×
MSDS (PDF)
×