Recombinant Human SMO Protein

Recombinant Human SMO Protein
SKU
ASBPP-3342-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99835

Gene Name: SMO

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys561

End Site: Thr700

Coverage: 0.20

Isoelectric Point: 10.5

Core Sequence: KRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 87%, Cynomolgus monkey - 100%

Alternative gene names: SMOH

Alternative protein names: Protein smoothened; Protein Gx

Protein name: smoothened, frizzled class receptor

Full length: 787 amino acids

Entry name: SMO_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3342-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3342-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6608
Product information (PDF)
×
MSDS (PDF)
×