Recombinant Human SNAPC4 Protein

Recombinant Human SNAPC4 Protein
SKU
ASBPP-10360-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5SXM2

Gene Name: SNAPC4

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Ser41

End Site: His340

Coverage: 0.21

Isoelectric Point: 5

Core Sequence: SEADSLPSEDLDPADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELLVTKWKNWEKALLRKSVVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEKEIQDINQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQEWSREEEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 37%, Pig - 79%, Cynomolgus monkey - 96%

Alternative gene names: SNAP190

Alternative protein names: snRNA-activating protein complex subunit 4; SNAPc subunit 4; Proximal sequence element-binding transcription factor subunit alpha; PSE-binding factor subunit alpha; PTF subunit alpha; snRNA-activating protein complex 190 kDa subunit; SNAPc 190 kDa subunit

Protein name: small nuclear RNA activating complex polypeptide 4

Full length: 1469 amino acids

Entry name: SNPC4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10360-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10360-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6621
Product information (PDF)
×
MSDS (PDF)
×