Recombinant Human SNAPC5 Protein

Recombinant Human SNAPC5 Protein
SKU
ASBPP-3295-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75971

Gene Name: SNAPC5

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Met1

End Site: Ser98

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 89%

Alternative gene names: SNAP19

Alternative protein names: snRNA-activating protein complex subunit 5; SNAPc subunit 5; Small nuclear RNA-activating complex polypeptide 5; snRNA-activating protein complex 19 kDa subunit; SNAPc 19 kDa subunit

Protein name: small nuclear RNA activating complex polypeptide 5

Full length: 98 amino acids

Entry name: SNPC5_HUMAN
More Information
SKU ASBPP-3295-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3295-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10302
Product information (PDF)
×
MSDS (PDF)
×