Recombinant Human SNCG Protein

Recombinant Human SNCG Protein
SKU
ASBPP-037-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O76070

Gene Name: SNCG

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Ala11

End Site: Glu120

Coverage: 0.97

Isoelectric Point: 6

Core Sequence: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: BCSG1; PERSYN; PRSN

Alternative protein names: Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR

Protein name: synuclein gamma

Full length: 127 amino acids

Entry name: SYUG_HUMAN
More Information
SKU ASBPP-037-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-037-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6623
Product information (PDF)
×
MSDS (PDF)
×