Recombinant Human SNRNP35 Protein

Recombinant Human SNRNP35 Protein
SKU
ASBPP-3485-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q16560

Gene Name: SNRNP35

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Val171

End Site: Glu240

Coverage: 0.32

Isoelectric Point: 11

Core Sequence: VKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 75%, Pig - 85%, Cynomolgus monkey - 96%

Alternative gene names: HM1; U1SNRNPBP

Alternative protein names: U11/U12 small nuclear ribonucleoprotein 35 kDa protein; U11/U12 snRNP 35 kDa protein; U11/U12-35K; Protein HM-1; U1 snRNP-binding protein homolog

Protein name: small nuclear ribonucleoprotein U11/U12 subunit 35

Full length: 246 amino acids

Entry name: U1SBP_HUMAN
More Information
SKU ASBPP-3485-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3485-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 11066
Product information (PDF)
×
MSDS (PDF)
×