Recombinant Human SNRPD3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P62318

Gene Name: SNRPD3

Expression System: Escherichia coli

Molecular Weight: 51.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Arg51

End Site: Asn120

Coverage: 0.64

Isoelectric Point: 9.5

Core Sequence: RDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Small nuclear ribonucleoprotein Sm D3; Sm-D3; snRNP core protein D3

Protein name: small nuclear ribonucleoprotein D3 polypeptide

Full length: 126 amino acids

Entry name: SMD3_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-337-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-337-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6634