Recombinant Human SNURF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y675

Gene Name: SNURF

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Gly71

Coverage: 1.00

Isoelectric Point: 10.5

Core Sequence: MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 94%

Alternative gene names: /

Alternative protein names: SNRPN upstream reading frame protein

Protein name: SNRPN upstream open reading frame

Full length: 71 amino acids

Entry name: SNURF_HUMAN

• SKU: ASBPP-11679-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-11679-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8926