Recombinant Human SORBS2 Protein

Recombinant Human SORBS2 Protein
SKU
ASBPP-3063-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O94875

Gene Name: SORBS2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Ser221

End Site: Ser330

Coverage: 0.10

Isoelectric Point: 10.5

Core Sequence: SILQHERPASLYQSSIDRSLERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSPSSPSRAKGGDDSKICPSLCSYSGLNGNPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 86%, Pig - 94%, Cynomolgus monkey - 97%

Alternative gene names: ARGBP2; KIAA0777

Alternative protein names: Sorbin and SH3 domain-containing protein 2; Arg-binding protein 2; ArgBP2; Arg/Abl-interacting protein 2; Sorbin

Protein name: sorbin and SH3 domain containing 2

Full length: 1100 amino acids

Entry name: SRBS2_HUMAN
More Information
SKU ASBPP-3063-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3063-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8470
Product information (PDF)
×
MSDS (PDF)
×