Recombinant Human SORCS1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WY21

Gene Name: SORCS1

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Pro41

End Site: Ala150

Coverage: 0.11

Isoelectric Point: 10

Core Sequence: PHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 76%

Alternative gene names: SORCS

Alternative protein names: VPS10 domain-containing receptor SorCS1; hSorCS

Protein name: sortilin related VPS10 domain containing receptor 1

Full length: 1168 amino acids

Entry name: SORC1_HUMAN

• SKU: ASBPP-3296-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3296-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 114815