Recombinant Human SOX10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P56693

Gene Name: SOX10

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Arg151

End Site: Gly220

Coverage: 0.17

Isoelectric Point: 7

Core Sequence: RPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-10

Protein name: SRY-box transcription factor 10

Full length: 466 amino acids

Entry name: SOX10_HUMAN

Product panel: Neurodegenerative Diseases Marker,IHC Pathology,Neuroscience Biomarkers,DNA binding & Chromatin

• SKU: ASBPP-321-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-321-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6663