Recombinant Human SPAG16 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N0X2

Gene Name: SPAG16

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Ala11

End Site: Tyr220

Coverage: 0.35

Isoelectric Point: 5

Core Sequence: AVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: PF20

Alternative protein names: Sperm-associated antigen 16 protein; Pf20 protein homolog

Protein name: sperm associated antigen 16

Full length: 631 amino acids

Entry name: SPG16_HUMAN

• SKU: ASBPP-324-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-324-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79582