Recombinant Human SPAG4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPE6

Gene Name: SPAG4

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ser11

End Site: Leu120

Coverage: 0.29

Isoelectric Point: 7.5

Core Sequence: SSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEPALSAGVPGGTTWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 80%, Cynomolgus monkey - 94%

Alternative gene names: SUN4

Alternative protein names: Sperm-associated antigen 4 protein; Outer dense fiber-associated protein SPAG4; SUN domain-containing protein 4

Protein name: sperm associated antigen 4

Full length: 437 amino acids

Entry name: SPAG4_HUMAN

• SKU: ASBPP-3065-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3065-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6676