Recombinant Human SPINK1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P00995

Gene Name: SPINK1

Expression System: Escherichia coli

Molecular Weight: 7.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Asp24

End Site: Cys79

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 65%, Pig - 73%, Cynomolgus monkey - 91%

Alternative gene names: PSTI

Alternative protein names: Serine protease inhibitor Kazal-type 1; Pancreatic secretory trypsin inhibitor; Tumor-associated trypsin inhibitor; TATI

Protein name: serine peptidase inhibitor Kazal type 1

Full length: 79 amino acids

Entry name: ISK1_HUMAN

• SKU: ASBPP-3348-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3348-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6690