Recombinant Human SPOPL Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6IQ16

Gene Name: SPOPL

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Val181

End Site: Lys390

Coverage: 0.55

Isoelectric Point: 7

Core Sequence: VPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 33%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Speckle-type POZ protein-like; HIB homolog 2; Roadkill homolog 2

Protein name: speckle type BTB/POZ protein like

Full length: 392 amino acids

Entry name: SPOPL_HUMAN

• SKU: ASBPP-3059-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3059-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 339745