Recombinant Human SPRR1A Protein

Recombinant Human SPRR1A Protein
SKU
ASBPP-4191-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P35321

Gene Name: SPRR1A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Met1

End Site: Lys89

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 74%, Pig - 81%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Cornifin-A; 19 kDa pancornulin; SPRK; Small proline-rich protein IA; SPR-IA

Protein name: small proline rich protein 1A

Full length: 89 amino acids

Entry name: SPR1A_HUMAN
More Information
SKU ASBPP-4191-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4191-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6698
Product information (PDF)
×
MSDS (PDF)
×