Recombinant Human SPTY2D1 Protein

Recombinant Human SPTY2D1 Protein
SKU
ASBPP-10442-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68D10

Gene Name: SPTY2D1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Pro561

End Site: Lys680

Coverage: 0.19

Isoelectric Point: 5

Core Sequence: PPLSGYRAAQGPQRLPFPTGYKRQREYEEEDDDDDEYDSEMEDFIEDEGEPQEEISKHIREIFGYDRKKYKDESDYALRYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEEMQRRRAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Protein SPT2 homolog; Protein KU002155; SPT2 domain-containing protein 1

Protein name: SPT2 chromatin protein domain containing 1

Full length: 685 amino acids

Entry name: SPT2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10442-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10442-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 144108
Product information (PDF)
×
MSDS (PDF)
×