Recombinant Human STING1 Protein

Recombinant Human STING1 Protein
SKU
ASBPP-3345-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86WV6

Gene Name: STING1

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Arg191

End Site: Lys370

Coverage: 0.50

Isoelectric Point: 5

Core Sequence: RGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 75%, Pig - 79%, Cynomolgus monkey - 95%

Alternative gene names: ERIS; MITA; STING; TMEM173

Alternative protein names: Stimulator of interferon genes protein; hSTING; Endoplasmic reticulum interferon stimulator; ERIS; Mediator of IRF3 activation; hMITA; Transmembrane protein 173

Protein name: stimulator of interferon response cGAMP interactor 1

Full length: 379 amino acids

Entry name: STING_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3345-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3345-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 340061
Product information (PDF)
×
MSDS (PDF)
×