Recombinant Human STK17A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UEE5

Gene Name: STK17A

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Phe331

End Site: Gly410

Coverage: 0.21

Isoelectric Point: 5

Core Sequence: FRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPG

Homologies: Highest protein sequence identity to the following orthologs: Pig - 78%, Cynomolgus monkey - 99%

Alternative gene names: DRAK1

Alternative protein names: Serine/threonine-protein kinase 17A; DAP kinase-related apoptosis-inducing protein kinase 1

Protein name: serine/threonine kinase 17a

Full length: 414 amino acids

Entry name: ST17A_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3370-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3370-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9263