Note: Dry Ice fees will be extra-charged
Uniprot: Q13043
Gene Name: STK4
Expression System: Escherichia coli
Molecular Weight: 24 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 94%
Start Site: Lys301
End Site: Lys480
Coverage: 0.40
Isoelectric Point: 4.5
Core Sequence: KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 56%, Pig - 96%, Cynomolgus monkey - 99%
Alternative gene names: KRS2; MST1
Alternative protein names: Serine/threonine-protein kinase 4; Mammalian STE20-like protein kinase 1; MST-1; STE20-like kinase MST1; Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit; MST1/N; Serine/threonine-protein kinase 4 18kDa subunit; MST1/C]
Protein name: serine/threonine kinase 4
Full length: 487 amino acids
Entry name: STK4_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
