Recombinant Human STN1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H668

Gene Name: STN1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Glu191

End Site: Leu290

Coverage: 0.30

Isoelectric Point: 5.5

Core Sequence: EALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 66%

Alternative gene names: OBFC1

Alternative protein names: CST complex subunit STN1; Oligonucleotide/oligosaccharide-binding fold-containing protein 1; Suppressor of cdc thirteen homolog

Protein name: STN1 subunit of CST complex

Full length: 368 amino acids

Entry name: STN1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3319-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3319-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79991