Recombinant Human STRADA Protein

Recombinant Human STRADA Protein
SKU
ASBPP-4024-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q7RTN6

Gene Name: STRADA

Expression System: Escherichia coli

Molecular Weight: 44 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Gly31

End Site: Ile400

Coverage: 0.88

Isoelectric Point: 7

Core Sequence: GEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 93%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: LYK5; STRAD

Alternative protein names: STE20-related kinase adapter protein alpha; STRAD alpha; STE20-related adapter protein; Serologically defined breast cancer antigen NY-BR-96

Protein name: STE20 related adaptor alpha

Full length: 431 amino acids

Entry name: STRAA_HUMAN
More Information
SKU ASBPP-4024-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4024-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 92335
Product information (PDF)
×
MSDS (PDF)
×