Recombinant Human SUGP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IX01

Gene Name: SUGP2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Pro551

End Site: Lys650

Coverage: 0.10

Isoelectric Point: 7

Core Sequence: PMREEEKMIPPTKPEIQAKAPSSLSDAVPQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 35%, Pig - 79%, Cynomolgus monkey - 95%

Alternative gene names: KIAA0365; SFRS14

Alternative protein names: SURP and G-patch domain-containing protein 2; Arginine/serine-rich-splicing factor 14; Splicing factor; arginine/serine-rich 14

Protein name: SURP and G-patch domain containing 2

Full length: 1082 amino acids

Entry name: SUGP2_HUMAN

• SKU: ASBPP-3020-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3020-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10147