Recombinant Human SUMO1 Protein

Recombinant Human SUMO1 Protein
SKU
ASBPP-345-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P63165

Gene Name: SUMO1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Gly97

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: SMT3C; SMT3H3; UBL1

Alternative protein names: Small ubiquitin-related modifier 1; SUMO-1; GAP-modifying protein 1; GMP1; SMT3 homolog 3; Sentrin; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein SMT3C; Smt3C; Ubiquitin-like protein UBL1

Protein name: small ubiquitin like modifier 1

Full length: 101 amino acids

Entry name: SUMO1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-345-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-345-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7341
Product information (PDF)
×
MSDS (PDF)
×