Recombinant Human SUPV3L1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IYB8

Gene Name: SUPV3L1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Gly701

End Site: Lys780

Coverage: 0.12

Isoelectric Point: 10.5

Core Sequence: GTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 68%

Alternative gene names: SUV3

Alternative protein names: ATP-dependent RNA helicase SUPV3L1; mitochondrial; Suppressor of var1 3-like protein 1; SUV3-like protein 1

Protein name: Suv3 like RNA helicase

Full length: 786 amino acids

Entry name: SUV3_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-3324-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3324-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6832