Recombinant Human SYCE3 Protein

Recombinant Human SYCE3 Protein
SKU
ASBPP-3337-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A1L190

Gene Name: SYCE3

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Met1

End Site: Leu88

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: C22orf41; THEG2

Alternative protein names: Synaptonemal complex central element protein 3; Testis highly expressed gene 2 protein; THEG-2

Protein name: synaptonemal complex central element protein 3

Full length: 88 amino acids

Entry name: SYCE3_HUMAN
More Information
SKU ASBPP-3337-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3337-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 644186
Product information (PDF)
×
MSDS (PDF)
×