Recombinant Human SYNDIG1L Protein

Recombinant Human SYNDIG1L Protein
SKU
ASBPP-3305-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A6NDD5

Gene Name: SYNDIG1L

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Leu11

End Site: Asp160

Coverage: 0.68

Isoelectric Point: 4.5

Core Sequence: LLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRPSCLLGRDKVKEPRAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEESDATSTESESEDNFLTLPPRD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 40%, Pig - 85%

Alternative gene names: TMEM90A

Alternative protein names: Synapse differentiation-inducing gene protein 1-like; Capucin; Dispanin subfamily C member 1; DSPC1; Transmembrane protein 90A

Protein name: synapse differentiation inducing 1 like

Full length: 238 amino acids

Entry name: SYN1L_HUMAN
More Information
SKU ASBPP-3305-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3305-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 646658
Product information (PDF)
×
MSDS (PDF)
×