Recombinant Human SYT1 Protein

Recombinant Human SYT1 Protein
SKU
ASBPP-4051-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P21579

Gene Name: SYT1

Expression System: Escherichia coli

Molecular Weight: 40.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys91

End Site: Val420

Coverage: 0.81

Isoelectric Point: 9

Core Sequence: KKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: SVP65; SYT

Alternative protein names: Synaptotagmin-1; Synaptotagmin I; SytI; p65

Protein name: synaptotagmin 1

Full length: 422 amino acids

Entry name: SYT1_HUMAN

Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
More Information
SKU ASBPP-4051-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4051-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6857
Product information (PDF)
×
MSDS (PDF)
×