Recombinant Human SYT11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BT88

Gene Name: SYT11

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Pro51

End Site: Thr140

Coverage: 0.24

Isoelectric Point: 10

Core Sequence: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 85%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0080

Alternative protein names: Synaptotagmin-11; Synaptotagmin XI; SytXI

Protein name: synaptotagmin 11

Full length: 431 amino acids

Entry name: SYT11_HUMAN

• SKU: ASBPP-3031-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3031-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23208