Recombinant Human SYT4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H2B2

Gene Name: SYT4

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Lys41

End Site: Lys150

Coverage: 0.26

Isoelectric Point: 10

Core Sequence: KSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 84%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1342

Alternative protein names: Synaptotagmin-4; Synaptotagmin IV; SytIV

Protein name: synaptotagmin 4

Full length: 425 amino acids

Entry name: SYT4_HUMAN

• SKU: ASBPP-3035-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3035-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6860