Recombinant Human TAF12 Protein

Recombinant Human TAF12 Protein
SKU
ASBPP-3427-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q16514

Gene Name: TAF12

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Lys161

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: TAF15; TAF2J; TAFII20

Alternative protein names: Transcription initiation factor TFIID subunit 12; Transcription initiation factor TFIID 20/15 kDa subunits; TAFII-20/TAFII-15; TAFII20/TAFII15

Protein name: TATA-box binding protein associated factor 12

Full length: 161 amino acids

Entry name: TAF12_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3427-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3427-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6883
Product information (PDF)
×
MSDS (PDF)
×