Recombinant Human TAF6L Protein

Recombinant Human TAF6L Protein
SKU
ASBPP-3030-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6J9

Gene Name: TAF6L

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Asp471

End Site: Ser550

Coverage: 0.14

Isoelectric Point: 11.5

Core Sequence: DKKEPAAAPDSVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPGTGTRDVFQKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 91%, Cynomolgus monkey - 62%

Alternative gene names: PAF65A

Alternative protein names: TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L; TAF6L; PCAF-associated factor 65-alpha; PAF65-alpha

Protein name: TATA-box binding protein associated factor 6 like

Full length: 622 amino acids

Entry name: TAF6L_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3030-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3030-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10629
Product information (PDF)
×
MSDS (PDF)
×