Recombinant Human TAFA1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z5A9

Gene Name: TAFA1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Phe31

End Site: His130

Coverage: 0.94

Isoelectric Point: 8

Core Sequence: FQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 48%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: FAM19A1

Alternative protein names: Chemokine-like protein TAFA-1

Protein name: TAFA chemokine like family member 1

Full length: 133 amino acids

Entry name: TAFA1_HUMAN

• SKU: ASBPP-3032-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3032-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 407738