Recombinant Human TAFA5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z5A7

Gene Name: TAFA5

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Thr44

End Site: Ser132

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: TCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: FAM19A5

Alternative protein names: Chemokine-like protein TAFA-5

Protein name: TAFA chemokine like family member 5

Full length: 132 amino acids

Entry name: TAFA5_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3033-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3033-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 25817