Recombinant Human TAGLN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UI15

Gene Name: TAGLN3

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Met199

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: NP25

Alternative protein names: Transgelin-3; Neuronal protein 22; NP22; Neuronal protein NP25

Protein name: transgelin 3

Full length: 199 amino acids

Entry name: TAGL3_HUMAN

• SKU: ASBPP-4140-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4140-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 29114