Recombinant Human TAS1R1 Protein

Recombinant Human TAS1R1 Protein
SKU
ASBPP-3475-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q7RTX1

Gene Name: TAS1R1

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Ala91

End Site: Thr290

Coverage: 0.26

Isoelectric Point: 6.5

Core Sequence: ALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTVLAVIGPDSTNRAATTAALLSPFLVPMISYAASSETLSVKRQYPSFLRTIPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 72%, Pig - 71%, Cynomolgus monkey - 90%

Alternative gene names: GPR70; T1R1; TR1

Alternative protein names: Taste receptor type 1 member 1; G-protein coupled receptor 70

Protein name: taste 1 receptor member 1

Full length: 841 amino acids

Entry name: TS1R1_HUMAN
More Information
SKU ASBPP-3475-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3475-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 80835
Product information (PDF)
×
MSDS (PDF)
×