Recombinant Human TCEAL7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BRU2

Gene Name: TCEAL7

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Met1

End Site: Ile100

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 81%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Transcription elongation factor A protein-like 7; TCEA-like protein 7; Transcription elongation factor S-II protein-like 7

Protein name: transcription elongation factor A like 7

Full length: 100 amino acids

Entry name: TCAL7_HUMAN

• SKU: ASBPP-3457-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3457-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56849