Recombinant Human TCEAL8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IYN2

Gene Name: TCEAL8

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Asp21

End Site: His100

Coverage: 0.78

Isoelectric Point: 6

Core Sequence: DRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 68%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Transcription elongation factor A protein-like 8; TCEA-like protein 8; Transcription elongation factor S-II protein-like 8

Protein name: transcription elongation factor A like 8

Full length: 117 amino acids

Entry name: TCAL8_HUMAN

• SKU: ASBPP-3378-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3378-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 90843