Recombinant Human TCEAL9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHQ7

Gene Name: TCEAL9

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Pro11

End Site: Met90

Coverage: 0.88

Isoelectric Point: 6

Core Sequence: PENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 56%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: WBP5

Alternative protein names: Transcription elongation factor A protein-like 9; TCEA-like protein 9; Transcription elongation factor S-II protein-like 9; WW domain-binding protein 5; WBP-5

Protein name: transcription elongation factor A like 9

Full length: 104 amino acids

Entry name: TCAL9_HUMAN

• SKU: ASBPP-3471-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3471-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51186