Recombinant Human TCF7L1 Protein

Recombinant Human TCF7L1 Protein
SKU
ASBPP-3420-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCS4

Gene Name: TCF7L1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Glu391

End Site: Ala480

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: EQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 89%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: TCF3

Alternative protein names: Transcription factor 7-like 1; HMG box transcription factor 3; TCF-3

Protein name: transcription factor 7 like 1

Full length: 588 amino acids

Entry name: TF7L1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3420-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3420-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 83439
Product information (PDF)
×
MSDS (PDF)
×