Recombinant Human TCL1A Protein

Recombinant Human TCL1A Protein
SKU
ASBPP-3438-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P56279

Gene Name: TCL1A

Expression System: Escherichia coli

Molecular Weight: 55.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Met1

End Site: Asp114

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%

Alternative gene names: TCL1

Alternative protein names: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1

Protein name: TCL1 family AKT coactivator A

Full length: 114 amino acids

Entry name: TCL1A_HUMAN

Product panel: IHC Pathology
More Information
SKU ASBPP-3438-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3438-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8115
Product information (PDF)
×
MSDS (PDF)
×