Recombinant Human TCL1B Protein

Recombinant Human TCL1B Protein
SKU
ASBPP-3308-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95988

Gene Name: TCL1B

Expression System: Escherichia coli

Molecular Weight: 57 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Val11

End Site: Leu120

Coverage: 0.99

Isoelectric Point: 5.5

Core Sequence: VPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%

Alternative gene names: TCL1

Alternative protein names: T-cell leukemia/lymphoma protein 1B; Oncogene TCL-1B; Oncogene TCL1B; SYN-1; Syncytiotrophoblast-specific protein; TCL1/MTCP1-like protein 1

Protein name: TCL1 family AKT coactivator B

Full length: 128 amino acids

Entry name: TCL1B_HUMAN
More Information
SKU ASBPP-3308-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3308-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9623
Product information (PDF)
×
MSDS (PDF)
×