Recombinant Human TCP10L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDR4

Gene Name: TCP10L

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Pro111

End Site: Glu210

Coverage: 0.53

Isoelectric Point: 11.5

Core Sequence: PHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSSSNNSAPPKPMSLKIERISSWKTPPQENRDKNLSRRRQDRRATPTGRPTPCAE

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: T-complex protein 10A homolog 1; T-complex protein 10A-1; TCP10A-1; TCP10-like

Protein name: t-complex 10 like

Full length: 215 amino acids

Entry name: TCP1L_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3456-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3456-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 140290