Recombinant Human TEAD2 Protein

Recombinant Human TEAD2 Protein
SKU
ASBPP-3325-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q15562

Gene Name: TEAD2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Glu21

End Site: Lys120

Coverage: 0.24

Isoelectric Point: 9

Core Sequence: EGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: TEF4

Alternative protein names: Transcriptional enhancer factor TEF-4; TEA domain family member 2; TEAD-2

Protein name: TEA domain transcription factor 2

Full length: 447 amino acids

Entry name: TEAD2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3325-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3325-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8463
Product information (PDF)
×
MSDS (PDF)
×