Recombinant Human TECRL Protein

Recombinant Human TECRL Protein
SKU
ASBPP-4063-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5HYJ1

Gene Name: TECRL

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu11

End Site: Gln140

Coverage: 0.39

Isoelectric Point: 10.5

Core Sequence: ERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 45%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: SRD5A2L2

Alternative protein names: Trans-2; 3-enoyl-CoA reductase-like; Steroid 5-alpha-reductase 2-like 2 protein

Protein name: trans-2,3-enoyl-CoA reductase like

Full length: 363 amino acids

Entry name: TECRL_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4063-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4063-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 253017
Product information (PDF)
×
MSDS (PDF)
×