Note: Dry Ice fees will be extra-charged
Uniprot: Q5HYJ1
Gene Name: TECRL
Expression System: Escherichia coli
Molecular Weight: 17.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 77%
Start Site: Glu11
End Site: Gln140
Coverage: 0.39
Isoelectric Point: 10.5
Core Sequence: ERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQ
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 45%, Pig - 82%, Cynomolgus monkey - 96%
Alternative gene names: SRD5A2L2
Alternative protein names: Trans-2; 3-enoyl-CoA reductase-like; Steroid 5-alpha-reductase 2-like 2 protein
Protein name: trans-2,3-enoyl-CoA reductase like
Full length: 363 amino acids
Entry name: TECRL_HUMAN
Product panel: Enzyme