Recombinant Human TEX264 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6I9

Gene Name: TEX264

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Met181

End Site: Gly280

Coverage: 0.35

Isoelectric Point: 4

Core Sequence: MCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: ZSIG11

Alternative protein names: Testis-expressed protein 264; Putative secreted protein Zsig11

Protein name: testis expressed 264, ER-phagy receptor

Full length: 313 amino acids

Entry name: TX264_HUMAN

• SKU: ASBPP-3416-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3416-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51368