Recombinant Human TGFA Protein

Recombinant Human TGFA Protein
SKU
ASBPP-3331-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P01135

Gene Name: TGFA

Expression System: Escherichia coli

Molecular Weight: 9 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ser31

End Site: Val90

Coverage: 0.54

Isoelectric Point: 6.5

Core Sequence: SADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha; TGF-alpha; EGF-like TGF; ETGF; TGF type 1]

Protein name: transforming growth factor alpha

Full length: 160 amino acids

Entry name: TGFA_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3331-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3331-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7039
Product information (PDF)
×
MSDS (PDF)
×