Recombinant Human TIGD3 Protein

Recombinant Human TIGD3 Protein
SKU
ASBPP-3060-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6B0B8

Gene Name: TIGD3

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Pro371

End Site: Thr450

Coverage: 0.18

Isoelectric Point: 5.5

Core Sequence: PPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRWFECNST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 79%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Tigger transposable element-derived protein 3

Protein name: tigger transposable element derived 3

Full length: 471 amino acids

Entry name: TIGD3_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3060-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3060-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 220359
Product information (PDF)
×
MSDS (PDF)
×