Recombinant Human TIGD4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IY51

Gene Name: TIGD4

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Glu431

End Site: Ser510

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: EAAPNGDSICTKESKSDETGFYTSDEEDDDGSPGTELPLPSKSEAITALDTLKKFLRSQDMNDGLQNSLADLENFINSLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Pig - 78%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Tigger transposable element-derived protein 4

Protein name: tigger transposable element derived 4

Full length: 512 amino acids

Entry name: TIGD4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3061-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3061-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 201798